🔔 ChEMBL Target Component Crosswalk

One structured record per ChEMBL target component — the component id, UniProt accession, component type, organism, the amino-acid sequence, synonyms, cross-references, GO slims, protein classifications, and the targets it participates in. A master crosswalk over ChEMBL's ~12,986 components, keyed and deduplicated on component_id. Built for target-informatics, sequence, and licensing teams who need ChEMBL's component crosswalk as clean facts. Built by NexGen Watch on Apify.

Differentiation: synonyms, xrefs, GO slims, classifications and target links are carried as verbatim arrays — isoforms and synonyms are never silently merged or deduplicated away. Sequence-heavy rows are sized honestly: the sequence is emitted verbatim and sequence_length states its length so no buyer is surprised by row size. Every row stamps the CC BY-SA notice.

Output is one chembl_target_component row per result; billing is pay-per-event, the value event being one target component record (a $0.02 start fee per run, then $0.02 per target component record). Source: www.ebi.ac.uk.

No login, no API key and no CAPTCHA solving are involved: the source is read logged-out with an identified contact User-Agent.

📊 Sample Output

Real rows from run W4RrjM04JFRDlKRjO on build 0.1.5 (2026-09-19), the same input as the Quick start below — every value is as the source published it (emails masked, long text shortened):

organism	description	protein_classifications	chembl_release	release_date	license
Rattus norvegicus	Gamma-aminobutyric acid receptor subunit pi	[{"protein_classification_id": 1173}]	ChEMBL_37	ChEMBL_37	CC BY-SA 3.0
Homo sapiens	Acetylcholine receptor subunit alpha	[{"protein_classification_id": 422}]	ChEMBL_37	ChEMBL_37	CC BY-SA 3.0
Homo sapiens	Cellular tumor antigen p53	[{"protein_classification_id": 12}]	ChEMBL_37	ChEMBL_37	CC BY-SA 3.0
Rattus norvegicus	Neuronal acetylcholine receptor subunit alpha-3	[{"protein_classification_id": 422}]	ChEMBL_37	ChEMBL_37	CC BY-SA 3.0
Homo sapiens	Integrin beta-3	[{"protein_classification_id": 11}]	ChEMBL_37	ChEMBL_37	CC BY-SA 3.0
Homo sapiens	Integrin beta-1	[{"protein_classification_id": 11}]	ChEMBL_37	ChEMBL_37	CC BY-SA 3.0
Homo sapiens	Cyclin-dependent kinase 1	[{"protein_classification_id": 323}]	ChEMBL_37	ChEMBL_37	CC BY-SA 3.0
Homo sapiens	Integrin alpha-V	[{"protein_classification_id": 11}]	ChEMBL_37	ChEMBL_37	CC BY-SA 3.0

The run finished with the status message: NORMAL: 50 unique rows (0 duplicates collapsed) from ChEMBL_37. billable=50

✅ What you get

Each row is flat JSON with these fields (from the dataset schema and the sample run; a field the source does not publish for a given row is null):

• record_type (string/null) — e.g. chembl_target_component
• component_id (string/null) — e.g. 1
• accession (string/null) — e.g. O09028
• component_type (string/null) — e.g. PROTEIN
• organism (string/null) — e.g. Rattus norvegicus
• tax_id (string/null) — e.g. 10116
• description (string/null) — e.g. Gamma-aminobutyric acid receptor subunit pi
• sequence (string/null) — e.g. MSYSLYLAFVCLNLLAQRMCIQGNQFNVEVSRSDKLSLPGFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNM
• sequence_length (string/integer/null) — e.g. 440
• target_component_synonyms (string/null) — e.g. [{"component_synonym": "GABA(A) receptor subunit pi", "syn_type": "UNIPROT"}, {"
• target_component_xrefs (string/null) — e.g. [{"xref_id": "O09028", "xref_name": null, "xref_src_db": "AlphaFoldDB"}, {"xref_
• go_slims (string/null) — e.g. [{"go_id": "GO:0003674"}, {"go_id": "GO:0005575"}, {"go_id": "GO:0005886"}, {"go
• protein_classifications (string/null) — e.g. [{"protein_classification_id": 1173}]
• targets (string/null) — e.g. [{"target_chembl_id": "CHEMBL1907607"}, {"target_chembl_id": "CHEMBL2096683"}]
• synonym_count (string/integer/null) — e.g. 4
• chembl_release (string/null) — e.g. ChEMBL_37
• source (string/null) — e.g. chembl-target-component-crosswalk
• release_date (string/null) — e.g. ChEMBL_37
• source_url (string/null) — e.g. https://www.ebi.ac.uk/chembl/api/data/target_component.json
• observed_at (string/null) — e.g. 2026-09-19T00:20:07Z
• license (string/null) — e.g. CC BY-SA 3.0
• attribution (string/null) — e.g. ChEMBL / EMBL-EBI (https://www.ebi.ac.uk/chembl/)
• terminal (string/null) — null in every sample row
• reported_total (string/integer/null) — null in every sample row
• raw_seen (string/integer/null) — null in every sample row
• duplicates (string/integer/null) — null in every sample row
• unique_found (string/integer/null) — null in every sample row
• delivered (string/integer/null) — null in every sample row
• scope (string/null) — null in every sample row
• note (string/null) — null in every sample row

✅ What you get

• record_type (string/null) — e.g. chembl_target_component
• component_id (string/null) — e.g. 1
• accession (string/null) — e.g. O09028
• component_type (string/null) — e.g. PROTEIN
• organism (string/null) — e.g. Rattus norvegicus
• tax_id (string/null) — e.g. 10116
• description (string/null) — e.g. Gamma-aminobutyric acid receptor subunit pi
• sequence (string/null) — e.g. MSYSLYLAFVCLNLLAQRMCIQGNQFNVEVSRSDKLSLPGFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNM
• sequence_length (string/integer/null) — e.g. 440
• target_component_synonyms (string/null) — e.g. [{"component_synonym": "GABA(A) receptor subunit pi", "syn_type": "UNIPROT"}, {"
• target_component_xrefs (string/null) — e.g. [{"xref_id": "O09028", "xref_name": null, "xref_src_db": "AlphaFoldDB"}, {"xref_
• go_slims (string/null) — e.g. [{"go_id": "GO:0003674"}, {"go_id": "GO:0005575"}, {"go_id": "GO:0005886"}, {"go
• protein_classifications (string/null) — e.g. [{"protein_classification_id": 1173}]
• targets (string/null) — e.g. [{"target_chembl_id": "CHEMBL1907607"}, {"target_chembl_id": "CHEMBL2096683"}]
• synonym_count (string/integer/null) — e.g. 4
• chembl_release (string/null) — e.g. ChEMBL_37
• source (string/null) — e.g. chembl-target-component-crosswalk
• release_date (string/null) — e.g. ChEMBL_37
• source_url (string/null) — e.g. https://www.ebi.ac.uk/chembl/api/data/target_component.json
• observed_at (string/null) — e.g. 2026-09-18T23:27:00Z
• license (string/null) — e.g. CC BY-SA 3.0
• attribution (string/null) — e.g. ChEMBL / EMBL-EBI (https://www.ebi.ac.uk/chembl/)
• terminal (string/null) — null in every sample row
• reported_total (string/integer/null) — null in every sample row
• raw_seen (string/integer/null) — null in every sample row
• duplicates (string/integer/null) — null in every sample row
• unique_found (string/integer/null) — null in every sample row
• delivered (string/integer/null) — null in every sample row
• scope (string/null) — null in every sample row
• note (string/null) — null in every sample row

⚙️ Sample inputs

1. Quick start — the Store example (this is what the sample above came from)

{
  "maxRecords": 10
}

The sample run charged exactly: 2 × $0.02 apify-actor-start + 50 × $0.02 target_component_record = $1.04 on the Free tier — every delivered row was billed.

2. A smaller, narrowed run

{
  "maxRecords": 5
}

Caps the run at 5 rows — about $0.12 on the Free tier ($0.02 start + 5 × $0.02).

3. A full-size run

{
  "maxRecords": 12986
}

Up to 12986 rows (the schema default for maxRecords) — about $259.74 on the Free tier ($0.02 start + 12986 × $0.02) if the source has that many.

🧾 JSON sample record

One real record from run W4RrjM04JFRDlKRjO, exactly as it lands in the dataset (emails masked, long text shortened):

{
  "record_type": "chembl_target_component",
  "component_id": "1",
  "accession": "O09028",
  "component_type": "PROTEIN",
  "organism": "Rattus norvegicus",
  "tax_id": "10116",
  "description": "Gamma-aminobutyric acid receptor subunit pi",
  "sequence": "MSYSLYLAFVCLNLLAQRMCIQGNQFNVEVSRSDKLSLPGFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEGNKSFTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMDLSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTLVTVSQQETGNYTRLVLQFELRR",
  "sequence_length": 440,
  "target_component_synonyms": "[{\"component_synonym\": \"GABA(A) receptor subunit pi\", \"syn_type\": \"UNIPROT\"}, {\"component_synonym\": \"GABAAR subunit pi\", \"syn_type\": \"UNIPROT\"}, {\"component_synonym\": \"Gabrp\", \"syn_type\": \"GENE_SYMBOL\"}, {\"component_synonym\": \"Gamma-aminobu",
  "target_component_xrefs": "[{\"xref_id\": \"O09028\", \"xref_name\": null, \"xref_src_db\": \"AlphaFoldDB\"}, {\"xref_id\": \"GO:0005886\", \"xref_name\": \"plasma membrane\", \"xref_src_db\": \"GoComponent\"}, {\"xref_id\": \"GO:0016020\", \"xref_name\": \"membrane\", \"xref_src_db\": \"GoComponent",
  "go_slims": "[{\"go_id\": \"GO:0003674\"}, {\"go_id\": \"GO:0005575\"}, {\"go_id\": \"GO:0005886\"}, {\"go_id\": \"GO:0006810\"}, {\"go_id\": \"GO:0016020\"}, {\"go_id\": \"GO:0022857\"}, {\"go_id\": \"GO:0055085\"}]",
  "protein_classifications": "[{\"protein_classification_id\": 1173}]",
  "targets": "[{\"target_chembl_id\": \"CHEMBL1907607\"}, {\"target_chembl_id\": \"CHEMBL2096683\"}]",
  "synonym_count": 4,
  "chembl_release": "ChEMBL_37",
  "source": "chembl-target-component-crosswalk",
  "release_date": "ChEMBL_37",
  "source_url": "https://www.ebi.ac.uk/chembl/api/data/target_component.json",
  "observed_at": "2026-09-19T00:20:07Z",
  "license": "CC BY-SA 3.0",
  "attribution": "ChEMBL / EMBL-EBI (https://www.ebi.ac.uk/chembl/)"
}

🔧 How it works

Source. The actor reads www.ebi.ac.uk — endpoints: https://www.ebi.ac.uk, https://www.ebi.ac.uk/chembl/, https://www.ebi.ac.uk/chembl/api/data/target_component.json. Public pages and feeds only; nothing behind a login.

Transport. Plain HTTPS from the Apify platform, no proxy. robots.txt is read first and a disallowed path is never fetched. Every request carries an identified contact User-Agent. Pacing: CRAWL_DELAY=10.0.

Charging. Each target component record is charged at the moment it is pushed (target_component_record); a row that fails to charge is not delivered, so the dataset count always equals the charged count.

🔧 How it works

Source

The public, keyless ChEMBL REST API at EMBL-EBI — https://www.ebi.ac.uk/chembl/api/data/target_component.json, paginated, serialized at a 10-second crawl delay, no parallel fan-out. robots.txt on www.ebi.ac.uk is honoured; the /chembl path is permitted.

Licence & attribution

ChEMBL is released by EMBL-EBI under Creative Commons Attribution-ShareAlike 3.0 (CC BY-SA 3.0):

• Attribution: ChEMBL / EMBL-EBI — https://www.ebi.ac.uk/chembl/
• Release: stamped per record (chembl_release).
• ShareAlike: redistribution or derivative works must be licensed under the same CC BY-SA 3.0.

Every record carries license = CC BY-SA 3.0 and attribution.

What is not done. No login, no cookie or CAPTCHA bypass, no private or personal-account data, no browser automation.

💰 Pricing example

Event	Free	Bronze	Silver	Gold
Actor Start (apify-actor-start)	$0.02	$0.02	$0.02	$0.02
Target Component Record (target_component_record)	$0.02	$0.018	$0.016	$0.0134

Worked at the live Free-tier price:

• 8 target component records: $0.02 start + 8 × $0.02 = $0.18
• 25 target component records: $0.02 start + 25 × $0.02 = $0.52
• 100 target component records: $0.02 start + 100 × $0.02 = $2.02

A run that delivers zero rows charges the $0.02 start fee only. A BLOCKED run (source refused) fails loud and charges no value event. The start fee is charged once per GB of run memory; the default run memory is 4096 MB.

Yield on the sample run: NORMAL: 50 unique rows (0 duplicates collapsed) from ChEMBL_37. billable=50. maxRecords is a hard ceiling on what is delivered and billed, never a target.

⚖️ Legal & ToS

This actor reads public, logged-out pages and feeds published by www.ebi.ac.uk. It collects only what the source publishes to any visitor, keeps to the source's robots rules (checked on every run), identifies itself with a contact User-Agent, and does not access accounts, private data or anything behind authentication. Use the output in line with the source's terms and your local law; the intended use is B2B research and monitoring.

❓ FAQ

Q: Do I need an API key or a login?
A: No. The source (www.ebi.ac.uk) is read logged-out; the input schema has no key field and the actor carries no secrets.

Q: Why did my run return 0 rows?
A: Read the run's status message. GENUINE_EMPTY means the source was read and had nothing in scope for your input; BLOCKED means the source refused and the run failed without billing a value event — retry later or narrow the input. A zero-row run bills the start fee only.

Q: How many rows can one run return?
A: Up to maxRecords (default 12986). Raise the cap for a bigger run; you pay per delivered row.

Q: How fresh is the data?
A: Every run reads the source live at run time; nothing is cached between runs. Put it on a schedule for a continuous feed.

Q: What formats can I export?
A: The dataset downloads as JSON, CSV, Excel, XML or RSS from the run's Dataset tab or the Apify API, and any run can push to a webhook or integration.

Q: How is this different from the other NexGen Watch actors actors?
A: Same output shape and billing model; this one covers www.ebi.ac.uk. The siblings under Related Actors cover the other sources or slices — run several on one schedule for a combined feed.

Q: Are there rate limits?
A: The actor paces itself against the source (CRAWL_DELAY=10.0) and honours its robots rules; there is no per-buyer limit beyond your Apify plan's concurrency.

🆘 Troubleshooting

• Run FAILED with BLOCKED → the source refused the request or changed its page shape → nothing was billed beyond the start fee; retry after a while, and if it persists open an Issue with the run id.
• Status says CAPPED → your cap (maxRecords) was reached → raise it for a bigger run.
• Input validation error on start → a field is outside the schema's allowed values → start from the Quick start block and change one field at a time.
• Run TIMED-OUT → a very wide request on a slow day → raise the run timeout in Run options or narrow the input; what was delivered before the timeout is still in the dataset.

🔗 Related Actors

• ChEMBL Target Assay Definition Screener — One structured record per assay for the ChEMBL target(s) you name — the assay id, type and description, category, organism/tissue/cell, BAO format/la…
• ChEMBL Target Bioactivity Screener — One structured bioactivity record per measured activity for the ChEMBL target(s) you name — the assay/target/molecule ids, the standard measurement (…
• ChEMBL Target Catalogue Master — One structured record per ChEMBL target — the target id, preferred name, organism, tax id, target type, species-group flag, cross-references, and the…
• Chicago Business Licenses — One record per Chicago business-licence record (type, status, dates, address, business activity, legal + DBA name) from the keyless Chicago Socrata r…
• Chicago Business Owners Register — One record per Chicago business owner/officer statutory-register row (account, DBA name, owner name parts, title) from the City's public Business Own…
• CMS Article Response-to-Comment Ledger — One structured record per filed public comment-and-response on a CMS Article — the article id and version, the response-to-comment number, the (HTML-…
• 🏢 About NexGenData — NexGen Watch is NexGenData's fleet of more than 300 public data actors built on official sources, pay-per-result. Browse the catalog at apify.com/nexgenwatch.

⭐ Found this useful?

If this actor saved you a manual check, a quick review on the Apify Store helps other teams find it. Feature request or a source that changed? Open it from the Issues tab — every one is read.